PRPSAP2 (NM_002767) Human Mass Spec Standard

SKU
PH310719
PRPSAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002758)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210719]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC210719 protein sequence
Red=Cloning site Green=Tags(s)

MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGK
DVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLT
HLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVI
HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLA
AAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIR
RIHNGESMSYLFRNIGLDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002758
RefSeq Size 2021
RefSeq ORF 1107
Synonyms PAP41
Locus ID 5636
UniProt ID O60256
Cytogenetics 17p11.2
Summary This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PRPSAP2 (NM_002767) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400988 PRPSAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400988 Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase-associated protein 2 (PRPSAP2) 100 ug
$436.00
TP310719 Recombinant protein of human phosphoribosyl pyrophosphate synthetase-associated protein 2 (PRPSAP2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.