CUTA (NM_001014837) Human Mass Spec Standard

SKU
PH310646
CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210646]
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC210646 protein sequence
Red=Cloning site Green=Tags(s)

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRL
AACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQW
VRQVTESVSDSITVLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001014837
RefSeq Size 1072
RefSeq ORF 468
Synonyms ACHAP; C6orf82
Locus ID 51596
UniProt ID O60888
Cytogenetics 6p21.32
Summary May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CUTA (NM_001014837) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300075 CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838) 10 ug
$3,255.00
PH319077 CUTA MS Standard C13 and N15-labeled recombinant protein (NP_057005) 10 ug
$3,255.00
LC414324 CUTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423090 CUTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423091 CUTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414324 Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2 100 ug
$436.00
LY423090 Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3 100 ug
$436.00
LY423091 Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 100 ug
$436.00
TP300075 Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310646 Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319077 Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720228 Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.