GFUS (NM_003313) Human Mass Spec Standard

SKU
PH310643
TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210643]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC210643 protein sequence
Red=Cloning site Green=Tags(s)

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA
AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN
FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT
GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF
KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003304
RefSeq Size 1363
RefSeq ORF 963
Synonyms FX; P35B; SDR4E1; TSTA3
Locus ID 7264
UniProt ID Q13630
Cytogenetics 8q24.3
Summary Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:GFUS (NM_003313) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418775 TSTA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418775 Transient overexpression lysate of tissue specific transplantation antigen P35B (TSTA3) 100 ug
$436.00
TP310643 Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720506 Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.