Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Mass Spec Standard

SKU
PH310613
MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210613]
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC210613 representing NM_170738
Red=Cloning site Green=Tags(s)

MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAG
IEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAA
FQKERAIFLAAQKEADLAAQEEAAKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_733934
RefSeq Size 762
RefSeq ORF 498
Synonyms CGI-113; L11MT; MRP-L11
Locus ID 65003
UniProt ID Q9Y3B7
Cytogenetics 11q13.2
Summary This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300033 MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_057134) 10 ug
$3,255.00
LC406858 MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414217 MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406858 Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY414217 Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP300033 Recombinant protein of human mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$867.00
TP310613 Purified recombinant protein of Homo sapiens mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.