INPP1 (NM_002194) Human Mass Spec Standard

SKU
PH310604
INPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002185)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210604]
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC210604 protein sequence
Red=Cloning site Green=Tags(s)

MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFP
GLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTE
INVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDP
NTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVC
GDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQ
LVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002185
RefSeq Size 2035
RefSeq ORF 1197
Locus ID 3628
UniProt ID P49441
Cytogenetics 2q32.2
Summary This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:INPP1 (NM_002194) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419477 INPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427029 INPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419477 Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2 100 ug
$436.00
LY427029 Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 1 100 ug
$436.00
TP310604 Recombinant protein of human inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.