Osteopontin (SPP1) (NM_001040060) Human Mass Spec Standard

SKU
PH310592
SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035149)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210592]
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC210592 protein sequence
Red=Cloning site Green=Tags(s)

MRIAVICFCLLGITCAIPVKQADSGSSEEKQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHV
DSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGL
RSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAET
HSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELD
SASSEVN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035149
RefSeq Size 1560
RefSeq ORF 861
Synonyms BNSP; BSPI; ETA-1; OPN
Locus ID 6696
UniProt ID P10451
Cytogenetics 4q22.1
Summary The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways ECM-receptor interaction, Focal adhesion, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:Osteopontin (SPP1) (NM_001040060) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304803 SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035147) 10 ug
$3,255.00
PH305118 SPP1 MS Standard C13 and N15-labeled recombinant protein (NP_000573) 10 ug
$3,255.00
LC400422 SPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421887 SPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424632 SPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400422 Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 3 100 ug
$436.00
LY421887 Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 1 100 ug
$436.00
LY424632 Transient overexpression lysate of secreted phosphoprotein 1 (SPP1), transcript variant 2 100 ug
$436.00
TP304803 Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, 20 µg 20 ug
$867.00
TP305118 Purified recombinant protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 2, 20 µg 20 ug
$867.00
TP310592 Purified recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 3, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg 20 ug
$867.00
TP710213 Purified protein of Homo sapiens secreted phosphoprotein 1 (SPP1), transcript variant 1, residues 17-314aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720449 Recombinant protein of human secreted phosphoprotein 1 (SPP1), transcript variant 2 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.