DNAJC15 (NM_013238) Human Mass Spec Standard

SKU
PH310567
DNAJC15 MS Standard C13 and N15-labeled recombinant protein (NP_037370)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210567]
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC210567 protein sequence
Red=Cloning site Green=Tags(s)

MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITE
TAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEA
KDLLETTTKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037370
RefSeq Size 2792
RefSeq ORF 450
Synonyms DNAJD1; HSD18; MCJ
Locus ID 29103
UniProt ID Q9Y5T4
Cytogenetics 13q14.11
Summary Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:DNAJC15 (NM_013238) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402228 DNAJC15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402228 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15) 100 ug
$436.00
TP310567 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.