Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human Mass Spec Standard

SKU
PH310550
ACOT4 MS Standard C13 and N15-labeled recombinant protein (NP_689544)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210550]
Predicted MW 46.1 kDa
Protein Sequence
Protein Sequence
>RC210550 representing NM_152331
Red=Cloning site Green=Tags(s)

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG
SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR
AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE
AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR
RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689544
RefSeq Size 1703
RefSeq ORF 1263
Synonyms PTE-Ib; PTE1B; PTE2B
Locus ID 122970
UniProt ID Q8N9L9
Cytogenetics 14q24.3
Summary Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:16940157). ACOT4 is a peroxisomal succinyl-coenzyme A thioesterase can also hydrolyze glutaryl-CoA and long chain saturated acyl-CoAs (PubMed:16940157).[UniProtKB/Swiss-Prot Function]
Protein Pathways Biosynthesis of unsaturated fatty acids
Write Your Own Review
You're reviewing:Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407636 ACOT4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407636 Transient overexpression lysate of acyl-CoA thioesterase 4 (ACOT4) 100 ug
$436.00
TP310550 Recombinant protein of human acyl-CoA thioesterase 4 (ACOT4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.