NDUFA4 (NM_002489) Human Mass Spec Standard

SKU PH310482

NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210482]
• Predicted MW: 9.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210482 protein sequence; Red=Cloning site Green=Tags(s); ; MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD; YSKLKKERPDF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002480
• RefSeq Size: 2058
• RefSeq ORF: 243
• Synonyms: CI-9k; CI-MLRQ; COXFA4; MC4DN21; MISTR1; MLRQ; MRCAF1
• Locus ID: 4697
• UniProt ID: O00483
• Cytogenetics: 7p21.3
• Summary: The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease