LBH (NM_030915) Human Mass Spec Standard

SKU
PH310467
LBH MS Standard C13 and N15-labeled recombinant protein (NP_112177)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210467]
Predicted MW 12.2 kDa
Protein Sequence
Protein Sequence
>RC210467 protein sequence
Red=Cloning site Green=Tags(s)

MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE
GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112177
RefSeq Size 2956
RefSeq ORF 315
Locus ID 81606
UniProt ID Q53QV2
Cytogenetics 2p23.1
Summary Transcriptional activator which may act in mitogen-activated protein kinase signaling pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LBH (NM_030915) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403092 LBH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403092 Transient overexpression lysate of limb bud and heart development homolog (mouse) (LBH) 100 ug
$436.00
TP310467 Recombinant protein of human limb bud and heart development homolog (mouse) (LBH), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.