HMG14 (HMGN1) (NM_004965) Human Mass Spec Standard

SKU PH310454

HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210454]
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC210454 protein sequence; Red=Cloning site Green=Tags(s); ; MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEANPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET; KEDLPAENGETKTEESPASDEAGEKEAKSD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004956
• RefSeq Size: 1313
• RefSeq ORF: 300
• Synonyms: HMG14
• Locus ID: 3150
• UniProt ID: P05114
• Cytogenetics: 21q22.2
• Summary: The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provided by RefSeq, Aug 2011]
• Protein Families: Transcription Factors