ACCN1 (ASIC2) (NM_001094) Human Mass Spec Standard

SKU
PH310409
ACCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001085)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210409]
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC210409 protein sequence
Red=Cloning site Green=Tags(s)

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY
QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK
ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK
GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT
YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL
AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE
TISHTVNVPLQTTLGTLEEIAC

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001085
RefSeq Size 2747
RefSeq ORF 1536
Synonyms ACCN; ACCN1; ASIC2a; BNaC1; BNC1; hBNaC1; MDEG
Locus ID 40
UniProt ID Q16515
Cytogenetics 17q11.2-q12
Summary This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome, Ion Channels: Other
Protein Pathways Taste transduction
Write Your Own Review
You're reviewing:ACCN1 (ASIC2) (NM_001094) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400449 ASIC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405257 ASIC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400449 Transient overexpression lysate of amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2 100 ug
$436.00
LY405257 Transient overexpression lysate of amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1 100 ug
$665.00
TP310409 Recombinant protein of human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.