Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Mass Spec Standard

SKU
PH310404
F2RL3 MS Standard C13 and N15-labeled recombinant protein (NP_003941)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210404]
Predicted MW 41.13 kDa
Protein Sequence
Protein Sequence
>RC210404 representing NM_003950
Red=Cloning site Green=Tags(s)

MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRAL
LLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQ
RWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALP
LTLQRQTFRLARSDRVLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGH
ALRLTAVVLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDK
VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003941
RefSeq Size 2731
RefSeq ORF 1155
Synonyms PAR4
Locus ID 9002
UniProt ID Q96RI0
Cytogenetics 19p13.11
Summary This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and activates the receptor. This receptor plays a role in blood coagulation, inflammation and response to pain. Hypomethylation at this gene may be associated with lung cancer in human patients. [provided by RefSeq, Sep 2016]
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401297 F2RL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401297 Transient overexpression lysate of coagulation factor II (thrombin) receptor-like 3 (F2RL3) 100 ug
$436.00
TP310404 Recombinant protein of human coagulation factor II (thrombin) receptor-like 3 (F2RL3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.