SLAMF9 (NM_033438) Human Mass Spec Standard

SKU
PH310366
SLAMF9 MS Standard C13 and N15-labeled recombinant protein (NP_254273)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210366]
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC210366 protein sequence
Red=Cloning site Green=Tags(s)

MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEG
HPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITV
NFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVS
SCPIPDGPFYADPNYASEKPSTAFCLLAKGLLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRK
EAKPGSSPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_254273
RefSeq Size 1170
RefSeq ORF 867
Synonyms CD2F-10; CD2F10; CD84-H1; CD84H1; SF2001
Locus ID 89886
UniProt ID Q96A28
Cytogenetics 1q23.2
Summary This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SLAMF9 (NM_033438) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409497 SLAMF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409497 Transient overexpression lysate of SLAM family member 9 (SLAMF9), transcript variant 1 100 ug
$436.00
TP310366 Recombinant protein of human SLAM family member 9 (SLAMF9), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.