Serine racemase (SRR) (NM_021947) Human Mass Spec Standard

SKU
PH310359
SRR MS Standard C13 and N15-labeled recombinant protein (NP_068766)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210359]
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC210359 protein sequence
Red=Cloning site Green=Tags(s)

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD
ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK
RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE
PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL
LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068766
RefSeq Size 2477
RefSeq ORF 1020
Synonyms ILV1; ISO1
Locus ID 63826
UniProt ID Q9GZT4
Cytogenetics 17p13.3
Summary Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.[UniProtKB/Swiss-Prot Function]
Protein Pathways Glycine, serine and threonine metabolism
Write Your Own Review
You're reviewing:Serine racemase (SRR) (NM_021947) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402897 SRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402897 Transient overexpression lysate of serine racemase (SRR) 100 ug
$436.00
TP310359 Recombinant protein of human serine racemase (SRR), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.