MARK2 (NM_004954) Human Mass Spec Standard

SKU
PH310279
MARK2 MS Standard C13 and N15-labeled recombinant protein (NP_004945)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210279]
Predicted MW 81.2 kDa
Protein Sequence
Protein Sequence
>RC210279 protein sequence
Red=Cloning site Green=Tags(s)

MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLA
RHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDY
LVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFC
GSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENL
LKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQR
YNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAGPAIPTSN
SYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLER
ASLGQASIQNGKDSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGV
TPASPSGHSQGRRGASGSIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLR
FTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVR
FKRISGTSMAFKNIASKIANELKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004945
RefSeq Size 4556
RefSeq ORF 2172
Synonyms EMK-1; EMK1; PAR-1; Par-1b; Par1b
Locus ID 2011
UniProt ID Q7KZI7
Cytogenetics 11q13.1
Summary This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2009]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:MARK2 (NM_004954) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413771 MARK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417631 MARK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413771 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 1 100 ug
$665.00
LY417631 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 3 100 ug
$436.00
TP310279 Recombinant protein of human MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 2, 20 µg 20 ug
$737.00
TP760915 Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 2 (MARK2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.