KCNJ5 (NM_000890) Human Mass Spec Standard

SKU
PH310184
KCNJ5 MS Standard C13 and N15-labeled recombinant protein (NP_000881)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210184]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC210184
Blue=ORF Red=Cloning site Green=Tag(s)

MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQE
TYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVS
AFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAV
ISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLII
SHEINEKSPFWEMSQAQLHQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYE
VDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSRE
ARGSV

myc-FLAG tag

Recombinant protein using RC210184 also available, TP310184
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000881
RefSeq Size 2912
RefSeq ORF 1257
Synonyms CIR; GIRK4; KATP1; KIR3.4; LQT13
Locus ID 3762
UniProt ID P48544
Cytogenetics 11q24.3
Summary This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
Write Your Own Review
You're reviewing:KCNJ5 (NM_000890) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424464 KCNJ5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424464 Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 5 (KCNJ5) 100 ug
$436.00
TP310184 Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 5 (KCNJ5), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.