FGF 23 (FGF23) (NM_020638) Human Mass Spec Standard

SKU
PH310127
FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210127]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC210127 protein sequence
Red=Cloning site Green=Tags(s)

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY
SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR
AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL
PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065689
RefSeq Size 3018
RefSeq ORF 753
Synonyms ADHR; FGFN; HFTC2; HPDR2; HYPF; PHPTC
Locus ID 8074
UniProt ID Q9GZV9
Cytogenetics 12p13.32
Summary This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:FGF 23 (FGF23) (NM_020638) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412413 FGF23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412413 Transient overexpression lysate of fibroblast growth factor 23 (FGF23) 100 ug
$436.00
TP310127 Recombinant protein of human fibroblast growth factor 23 (FGF23), 20 µg 20 ug
$737.00
TP750171 Purified recombinant protein of Rabbit FGF23, full length, with C-terminal myc-DDK tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.