MOX1 (MEOX1) (NM_004527) Human Mass Spec Standard

SKU
PH310106
MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210106]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC210106 protein sequence
Red=Cloning site Green=Tags(s)

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT
PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST
ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL
SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004518
RefSeq Size 2330
RefSeq ORF 762
Synonyms KFS2; MOX1
Locus ID 4222
UniProt ID P50221
Cytogenetics 17q21.31
Summary This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:MOX1 (MEOX1) (NM_004527) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417902 MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421872 MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417902 Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 1 100 ug
$436.00
LY421872 Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 3 100 ug
$436.00
TP310106 Recombinant protein of human mesenchyme homeobox 1 (MEOX1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.