OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRASP65 (GORASP1) (NM_031899) Human Mass Spec Standard

Be the first to review this product
SKU
PH310076
GORASP1 MS Standard C13 and N15-labeled recombinant protein (NP_114105)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501309 Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5G8 (formerly 5G8) 100 ul
$447.00
LY403127 Transient overexpression lysate of golgi reassembly stacking protein 1, 65kDa (GORASP1) (as WB positive control) 100 ug
$436.00

Other products for "GRASP65 or NM_031899"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210076
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC210076 protein sequence
Red=Cloning site Green=Tags(s)

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLE
VFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSD
QILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYH
KKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAP
DPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSS
SSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
LDTGTEAEGLDSQAQISTTE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114105
RefSeq Size 3789
RefSeq ORF 1320
Synonyms GOLPH5; GRASP65; P65
Locus ID 64689
UniProt ID Q9BQQ3
Cytogenetics 3p22.2
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Alternative splicing results in multiple transcript variants of this gene. provided by RefSeq, Jul 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRASP65" proteins (3)
SKU Description Size Price
LC403127 Lyophilized GORASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403127 Transient overexpression lysate of golgi reassembly stacking protein 1, 65kDa (GORASP1) (as WB positive control) 100 ug
$436.00
TP310076 Recombinant protein of human golgi reassembly stacking protein 1, 65kDa (GORASP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products