MIOX (NM_017584) Human Mass Spec Standard

SKU
PH310070
MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210070]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC210070 protein sequence
Red=Cloning site Green=Tags(s)

MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK
MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV
GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP
PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP
GILSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060054
RefSeq Size 1437
RefSeq ORF 855
Synonyms ALDRL6
Locus ID 55586
UniProt ID Q9UGB7
Cytogenetics 22q13.33
Protein Pathways Ascorbate and aldarate metabolism, Inositol phosphate metabolism
Write Your Own Review
You're reviewing:MIOX (NM_017584) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413679 MIOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413679 Transient overexpression lysate of myo-inositol oxygenase (MIOX) 100 ug
$436.00
TP310070 Recombinant protein of human myo-inositol oxygenase (MIOX), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.