OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MIOX (NM_017584) Human Mass Spec Standard

Be the first to review this product
SKU
PH310070
MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501421 MIOX mouse monoclonal antibody, clone OTI4G7 (formerly 4G7) 100 ul
$447.00
LY413679 Transient overexpression lysate of myo-inositol oxygenase (MIOX) (as WB positive control) 100 ug
$436.00

Other products for "MIOX or NM_017584"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210070
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC210070 protein sequence
Red=Cloning site Green=Tags(s)

MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK
MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV
GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP
PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP
GILSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060054
RefSeq Size 1437
RefSeq ORF 855
Synonyms ALDRL6
Locus ID 55586
UniProt ID Q9UGB7
Cytogenetics 22q13.33
Protein Pathways Ascorbate and aldarate metabolism, Inositol phosphate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MIOX" proteins (3)
SKU Description Size Price
LC413679 Lyophilized MIOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413679 Transient overexpression lysate of myo-inositol oxygenase (MIOX) (as WB positive control) 100 ug
$436.00
TP310070 Recombinant protein of human myo-inositol oxygenase (MIOX), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products