OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL22 (NM_020525) Human Mass Spec Standard

Be the first to review this product
SKU
PH309995
IL22 MS Standard C13 and N15-labeled recombinant protein (NP_065386)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326688 Rabbit Polyclonal IL-22 Antibody
100 ug
$640.00
LY412429 Transient overexpression lysate of interleukin 22 (IL22) (as WB positive control) 100 ug
$436.00

Other products for "IL22 or NM_020525"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209995
Predicted MW 20 kDa
Protein Sequence
Protein Sequence
>RC209995 protein sequence
Red=Cloning site Green=Tags(s)

MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT
DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH
IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065386
RefSeq Size 1147
RefSeq ORF 537
Synonyms IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18
Locus ID 50616
UniProt ID Q9GZX6
Cytogenetics 12q15
Summary This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. provided by RefSeq, Jul 2018
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL22" proteins (5)
SKU Description Size Price
LC412429 Lyophilized IL22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412429 Transient overexpression lysate of interleukin 22 (IL22) (as WB positive control) 100 ug
$436.00
TP309995 Recombinant protein of human interleukin 22 (IL22), 20 µg 20 ug
$867.00
TP721182 Purified recombinant protein of Human interleukin 22 (IL22) 10 ug
$340.00
TP723717 Purified recombinant protein of Human interleukin 22 (IL22) 10 ug
$475.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products