IRF3 (NM_001571) Human Mass Spec Standard

SKU
PH309951
IRF3 MS Standard C13 and N15-labeled recombinant protein (NP_001562)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209951]
Predicted MW 47.2 kDa
Protein Sequence
Protein Sequence
>RC209951 protein sequence
Red=Cloning site Green=Tags(s)

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDK
PDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDIL
DELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFY
RGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQW
LWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE
SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001562
RefSeq Size 1626
RefSeq ORF 1281
Synonyms IIAE7
Locus ID 3661
UniProt ID Q14653
Cytogenetics 19q13.33
Summary This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7. [provided by RefSeq, Sep 2020]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IRF3 (NM_001571) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400600 IRF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434143 IRF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434202 IRF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400600 Transient overexpression lysate of interferon regulatory factor 3 (IRF3) 100 ug
$436.00
LY434143 Transient overexpression lysate of interferon regulatory factor 3 (IRF3), transcript variant 4 100 ug
$436.00
LY434202 Transient overexpression lysate of interferon regulatory factor 3 (IRF3), transcript variant 3 100 ug
$436.00
TP309951 Recombinant protein of human interferon regulatory factor 3 (IRF3), 20 µg 20 ug
$737.00
TP331144 Purified recombinant protein of Homo sapiens interferon regulatory factor 3 (IRF3), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.