OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRRC32 (NM_005512) Human Mass Spec Standard

Be the first to review this product
SKU
PH309831
LRRC32 MS Standard C13 and N15-labeled recombinant protein (NP_005503)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337028 Rabbit Polyclonal LRRC32/GARP Antibody
100 ug
$540.00
LY401690 Transient overexpression lysate of leucine rich repeat containing 32 (LRRC32), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LRRC32 or NM_005512"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209831
Predicted MW 72 kDa
Protein Sequence
Protein Sequence
>RC209831 protein sequence
Red=Cloning site Green=Tags(s)

MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLG
FYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGL
LERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLT
CISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLP
TGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNC
LRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLE
ASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLE
TSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLII
ILTFILVSAILLTTLAACCCVRRQKFNQQYKA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005503
RefSeq Size 4327
RefSeq ORF 1986
Synonyms CPPRDD; D11S833E; GARP
Locus ID 2615
UniProt ID Q14392
Cytogenetics 11q13.5
Summary This gene encodes a type I membrane protein which contains 20 leucine-rich repeats. Alterations in the chromosomal region 11q13-11q14 are involved in several pathologies. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRC32" proteins (5)
SKU Description Size Price
LC401690 Lyophilized LRRC32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427024 Lyophilized LRRC32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401690 Transient overexpression lysate of leucine rich repeat containing 32 (LRRC32), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427024 Transient overexpression lysate of leucine rich repeat containing 32 (LRRC32), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309831 Recombinant protein of human leucine rich repeat containing 32 (LRRC32), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products