HDDC2 (NM_016063) Human Mass Spec Standard

SKU
PH309808
HDDC2 MS Standard C13 and N15-labeled recombinant protein (NP_057147)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209808]
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC209808 protein sequence
Red=Cloning site Green=Tags(s)

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVK
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057147
RefSeq Size 1615
RefSeq ORF 612
Synonyms C6orf74; CGI-130; dJ167O5.2; NS5ATP2
Locus ID 51020
UniProt ID Q7Z4H3
Cytogenetics 6q22.31
Summary Catalyzes the dephosphorylation of the nucleoside 5'-monophosphates deoxyadenosine monophosphate (dAMP), deoxycytidine monophosphate (dCMP), deoxyguanosine monophosphate (dGMP) and deoxythymidine monophosphate (dTMP).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HDDC2 (NM_016063) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414212 HDDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414212 Transient overexpression lysate of HD domain containing 2 (HDDC2) 100 ug
$436.00
TP309808 Recombinant protein of human HD domain containing 2 (HDDC2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.