OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VCAM1 (NM_001078) Human Mass Spec Standard

Be the first to review this product
SKU
PH309761
VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001069)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502391 VCAM1 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10) 100 ul
$447.00
LY421491 Transient overexpression lysate of vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "VCAM1 or NM_001078"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209761
Predicted MW 81.3 kDa
Protein Sequence
Protein Sequence
>RC209761 protein sequence
Red=Cloning site Green=Tags(s)

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001069
RefSeq Size 3220
RefSeq ORF 2217
Synonyms CD106; INCAM-100
Locus ID 7412
UniProt ID P19320
Cytogenetics 1p21.2
Summary This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. provided by RefSeq, Dec 2010
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VCAM1" proteins (6)
SKU Description Size Price
PH313353 VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_542413) 10 ug
$3,360.00
LC421491 Lyophilized VCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421491 Transient overexpression lysate of vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP309761 Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, 20 µg 20 ug
$867.00
TP313353 Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 2, 20 µg 20 ug
$737.00
TP720627 Purified recombinant protein of Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 10 ug
$190.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products