VCAM1 (NM_001078) Human Mass Spec Standard

SKU
PH309761
VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001069)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209761]
Predicted MW 81.3 kDa
Protein Sequence
Protein Sequence
>RC209761 protein sequence
Red=Cloning site Green=Tags(s)

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001069
RefSeq Size 3220
RefSeq ORF 2217
Synonyms CD106; INCAM-100
Locus ID 7412
UniProt ID P19320
Cytogenetics 1p21.2
Summary This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2010]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
Write Your Own Review
You're reviewing:VCAM1 (NM_001078) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313353 VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_542413) 10 ug
$3,255.00
LC421491 VCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421491 Transient overexpression lysate of vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 100 ug
$436.00
TP309761 Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, 20 µg 20 ug
$867.00
TP313353 Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 2, 20 µg 20 ug
$737.00
TP720627 Purified recombinant protein of Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.