XAGE2 (NM_130777) Human Mass Spec Standard

SKU PH309757

XAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_570133)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC209757]
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC209757 protein sequence; Red=Cloning site Green=Tags(s); ; MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL; QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_570133
• RefSeq Size: 651
• RefSeq ORF: 333
• Synonyms: CT12.2; GAGED3; XAGE-2; XAGE2B
• Locus ID: 9502
• UniProt ID: Q96GT9
• Cytogenetics: Xp11.22
• Summary: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008]