ZNF313 (RNF114) (NM_018683) Human Mass Spec Standard

SKU
PH309752
RNF114 MS Standard C13 and N15-labeled recombinant protein (NP_061153)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209752]
Predicted MW 25.7 kDa
Protein Sequence
Protein Sequence
>RC209752 protein sequence
Red=Cloning site Green=Tags(s)

MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA
LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT
FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD
VDEEDMMNQVLQRSIIDQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061153
RefSeq Size 2478
RefSeq ORF 684
Synonyms PSORS12; ZNF313
Locus ID 55905
UniProt ID Q9Y508
Cytogenetics 20q13.13
Summary E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZNF313 (RNF114) (NM_018683) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412984 RNF114 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412984 Transient overexpression lysate of ring finger protein 114 (RNF114) 100 ug
$436.00
TP309752 Recombinant protein of human ring finger protein 114 (RNF114), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.