RAB26 (NM_014353) Human Mass Spec Standard

SKU
PH309740
RAB26 MS Standard C13 and N15-labeled recombinant protein (NP_055168)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209740]
Predicted MW 27.9 kDa
Protein Sequence
Protein Sequence
>RC209740 protein sequence
Red=Cloning site Green=Tags(s)

MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG
DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL
LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT
GLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCCRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055168
RefSeq Size 1641
RefSeq ORF 768
Synonyms V46133
Locus ID 25837
UniProt ID Q9ULW5
Cytogenetics 16p13.3
Summary Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).[supplied by OMIM, Nov 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB26 (NM_014353) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415337 RAB26 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415337 Transient overexpression lysate of RAB26, member RAS oncogene family (RAB26) 100 ug
$436.00
TP309740 Recombinant protein of human RAB26, member RAS oncogene family (RAB26), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.