Cytochrome C (CYCS) (NM_018947) Human Mass Spec Standard

SKU PH309724

CYCS MS Standard C13 and N15-labeled recombinant protein (NP_061820)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC209724]
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC209724 protein sequence; Red=Cloning site Green=Tags(s); ; MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKIGQAPGYSYTAANKNKGIIWGEDTLMEYLE; NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_061820
• RefSeq Size: 5544
• RefSeq ORF: 315
• Synonyms: CYC; HCS; THC4
• Locus ID: 54205
• UniProt ID: P99999
• Cytogenetics: 7p15.3
• Summary: This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Huntington's disease, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Small cell lung cancer, Viral myocarditis