TPK1 (NM_022445) Human Mass Spec Standard

SKU
PH309721
TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209721]
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC209721 protein sequence
Red=Cloning site Green=Tags(s)

MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING
DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN
TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA
FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071890
RefSeq Size 2449
RefSeq ORF 729
Synonyms HTPK1; PP20; THMD5
Locus ID 27010
UniProt ID Q9H3S4
Cytogenetics 7q35
Summary The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Thiamine metabolism
Write Your Own Review
You're reviewing:TPK1 (NM_022445) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411708 TPK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420935 TPK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411708 Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 100 ug
$436.00
LY420935 Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 100 ug
$436.00
TP309721 Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.