C5orf45 (MRNIP) (NM_016175) Human Mass Spec Standard

SKU
PH309653
C5orf45 MS Standard C13 and N15-labeled recombinant protein (NP_057259)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209653]
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC209653 protein sequence
Red=Cloning site Green=Tags(s)

MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELP
LRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGP
RFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRG
PGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPT
AAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057259
RefSeq Size 1229
RefSeq ORF 1029
Synonyms C5orf45
Locus ID 51149
UniProt ID Q6NTE8
Cytogenetics 5q35.3
Summary Plays a role in the cellular response to DNA damage and the maintenance of genome stability through its association with the MRN damage-sensing complex (PubMed:27568553). Promotes chromatin loading and activity of the MRN complex to facilitate subsequent ATM-mediated DNA damage response signaling and DNA repair (PubMed:27568553).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C5orf45 (MRNIP) (NM_016175) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414145 C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422227 C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414145 Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 1 100 ug
$436.00
LY422227 Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 2 100 ug
$436.00
TP309653 Recombinant protein of human chromosome 5 open reading frame 45 (C5orf45), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.