HMBOX1 (NM_024567) Human Mass Spec Standard

SKU
PH309647
HMBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_078843)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209647]
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC209647 protein sequence
Red=Cloning site Green=Tags(s)

MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS
SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHAN
SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG
SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLA
VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES
HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078843
RefSeq Size 3233
RefSeq ORF 1260
Synonyms HNF1LA; HOT1; PBHNF; TAH1
Locus ID 79618
UniProt ID Q6NT76
Cytogenetics 8p21.1-p12
Summary Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA (PubMed:23813958, PubMed:23685356). Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation (PubMed:23685356). Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres (By similarity). Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs) (PubMed:23813958). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination (PubMed:23813958). Might also be involved in the DNA damage response at telomeres (PubMed:23813958).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HMBOX1 (NM_024567) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411234 HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427683 HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411234 Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 1 100 ug
$436.00
LY427683 Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 2 100 ug
$436.00
TP309647 Recombinant protein of human homeobox containing 1 (HMBOX1), transcript variant 1, 20 µg 20 ug
$737.00
TP761488 Purified recombinant protein of Human homeobox containing 1 (HMBOX1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.