CIAPIN1 (NM_020313) Human Mass Spec Standard

SKU
PH309626
CIAPIN1 MS Standard C13 and N15-labeled recombinant protein (NP_064709)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209626]
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC209626 protein sequence
Red=Cloning site Green=Tags(s)

MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG
STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV
QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG
DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064709
RefSeq Size 2106
RefSeq ORF 936
Synonyms Anamorsin; CIAE2; DRE2; PRO0915
Locus ID 57019
UniProt ID Q6FI81
Cytogenetics 16q21
Summary CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CIAPIN1 (NM_020313) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412554 CIAPIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412554 Transient overexpression lysate of cytokine induced apoptosis inhibitor 1 (CIAPIN1) 100 ug
$436.00
TP309626 Recombinant protein of human cytokine induced apoptosis inhibitor 1 (CIAPIN1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.