OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Galectin 2 (LGALS2) (NM_006498) Human Mass Spec Standard

Be the first to review this product
SKU
PH309552
LGALS2 MS Standard C13 and N15-labeled recombinant protein (NP_006489)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803291 LGALS2 mouse monoclonal antibody, clone OTI6A8 (formerly 6A8) 100 ul
$447.00
LY416599 Transient overexpression lysate of lectin, galactoside-binding, soluble, 2 (LGALS2) (as WB positive control) 100 ug
$436.00

Other products for "Galectin 2 or NM_006498"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209552
Predicted MW 14.6 kDa
Protein Sequence
Protein Sequence
>RC209552 protein sequence
Red=Cloning site Green=Tags(s)

MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR
EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006489
RefSeq Size 543
RefSeq ORF 396
Synonyms HL14
Locus ID 3957
UniProt ID P05162
Cytogenetics 22q13.1
Summary The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of the protein, with a resultant increased risk of myocardial infarction. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Galectin 2" proteins (3)
SKU Description Size Price
LC416599 Lyophilized LGALS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416599 Transient overexpression lysate of lectin, galactoside-binding, soluble, 2 (LGALS2) (as WB positive control) 100 ug
$436.00
TP309552 Recombinant protein of human lectin, galactoside-binding, soluble, 2 (LGALS2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products