POFUT2 (NM_133635) Human Mass Spec Standard

SKU
PH309505
POFUT2 MS Standard C13 and N15-labeled recombinant protein (NP_598368)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209505]
Predicted MW 50 kDa
Protein Sequence
Protein Sequence
>RC209505 protein sequence
Red=Cloning site Green=Tags(s)

MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLL
KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL
QSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNT
SARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKL
GSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV
RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE
QPTHWKITY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_598368
RefSeq Size 2878
RefSeq ORF 1287
Synonyms C21orf80; FUT13
Locus ID 23275
UniProt ID Q9Y2G5
Cytogenetics 21q22.3
Summary Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:POFUT2 (NM_133635) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408775 POFUT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414699 POFUT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408775 Transient overexpression lysate of protein O-fucosyltransferase 2 (POFUT2), transcript variant 3 100 ug
$436.00
LY414699 Transient overexpression lysate of protein O-fucosyltransferase 2 (POFUT2), transcript variant 1 100 ug
$665.00
TP309505 Recombinant protein of human protein O-fucosyltransferase 2 (POFUT2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.