PLBD1 (NM_024829) Human Mass Spec Standard

SKU
PH309501
PLBD1 MS Standard C13 and N15-labeled recombinant protein (NP_079105)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209501]
Predicted MW 63.1 kDa
Protein Sequence
Protein Sequence
>RC209501 protein sequence
Red=Cloning site Green=Tags(s)

MTRGGPGGRPGLPQPPPLLLLLLLPLLLVTAEPPKPAGVYYATAYWMPAEKTVQVKNVMDKNGDAYGFYN
NSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEK
QDKWTRKNIKEYKTDSFWRHTGYVMAQIDGLYVGAKKRAILEGTKPMTLFQIQFLNSVGDLLDLIPSLSP
TKNGSLKVFKRWDMGHCSALIKVLPGFENILFAHSSWYTYAAMLRIYKHWDFNIIDKDTSSSRLSFSSYP
GFLESLDDFYILSSGLILLQTTNSVFNKTLLKQVIPETLLSWQRVRVANMMADSGKRWADIFSKYNSGTY
NNQYMVLDLKKVKLNHSLDKGTLYIVEQIPTYVEYSEQTDVLRKGYWPSYNVPFHEKIYNWSGYPLLVQK
LGLDYSYDLAPRAKIFRRDQGKVTDTASMKYIMRYNNYKKDPYSRGDPCNTICCREDLNSPNPSPGGCYD
TKVADIYLASQYTSYAISGPTVQGGLPVFRWDRFNKTLHQGMAEVYNFDFITMKPILKLDIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079105
RefSeq Size 1951
RefSeq ORF 1656
Locus ID 79887
UniProt ID Q6P4A8
Cytogenetics 12p13.1
Summary In view of the small size of the putative binding pocket, it has been proposed that it may act as an amidase or a peptidase (By similarity). Exhibits a weak phospholipase activity, acting on various phospholipids, including phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine and lysophospholipids.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PLBD1 (NM_024829) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410947 PLBD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410947 Transient overexpression lysate of phospholipase B domain containing 1 (PLBD1) 100 ug
$436.00
TP309501 Recombinant protein of human phospholipase B domain containing 1 (PLBD1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.