ARMC6 (NM_033415) Human Mass Spec Standard

SKU
PH309481
ARMC6 MS Standard C13 and N15-labeled recombinant protein (NP_219483)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209481]
Predicted MW 51.5 kDa
Protein Sequence
Protein Sequence
>RC209481 protein sequence
Red=Cloning site Green=Tags(s)

MVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGSQEPTHDILQML
SDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVL
TDGQPDLLDAQGLQLLVATLTQNADEADLTCSGIRCVRHACLKHEQNRQDLVKAGVLPLLTGAITHHGHH
TDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAFLDNPGILSELCGTLSRLAI
RNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVA
AMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKAGVQKQACMLIRNLVAHG
QAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRGNLAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_219483
RefSeq Size 2397
RefSeq ORF 1428
Synonyms R30923_1
Locus ID 93436
UniProt ID Q6NXE6
Cytogenetics 19p13.11
Summary The function of this gene's protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:ARMC6 (NM_033415) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409540 ARMC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409540 Transient overexpression lysate of armadillo repeat containing 6 (ARMC6) 100 ug
$436.00
TP309481 Recombinant protein of human armadillo repeat containing 6 (ARMC6), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.