RFP2 (TRIM13) (NM_213590) Human Mass Spec Standard

SKU
PH309480
TRIM13 MS Standard C13 and N15-labeled recombinant protein (NP_998755)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209480]
Predicted MW 47 kDa
Protein Sequence
Protein Sequence
>RC209480 protein sequence
Red=Cloning site Green=Tags(s)

MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQ
VNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERD
AFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLA
VMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKN
FDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGC
LSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_998755
RefSeq Size 7311
RefSeq ORF 1222
Synonyms CAR; DLEU5; LEU5; RFP2; RNF77
Locus ID 10206
UniProt ID O60858
Cytogenetics 13q14.2
Summary This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:RFP2 (TRIM13) (NM_213590) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403907 TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409472 TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417084 TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423484 TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429891 TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403907 Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 3 100 ug
$436.00
LY409472 Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 2 100 ug
$436.00
LY417084 Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 1 100 ug
$436.00
LY423484 Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 4 100 ug
$436.00
TP309480 Recombinant protein of human tripartite motif-containing 13 (TRIM13), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.