RFP2 (TRIM13) (NM_213590) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC209480] |
Predicted MW | 47 kDa |
Protein Sequence |
Protein Sequence
>RC209480 protein sequence
Red=Cloning site Green=Tags(s) MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQ VNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERD AFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLA VMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKN FDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGC LSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_998755 |
RefSeq Size | 7311 |
RefSeq ORF | 1222 |
Synonyms | CAR; DLEU5; LEU5; RFP2; RNF77 |
Locus ID | 10206 |
UniProt ID | O60858 |
Cytogenetics | 13q14.2 |
Summary | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403907 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409472 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417084 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423484 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429891 | TRIM13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403907 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 3 | 100 ug |
$436.00
|
|
LY409472 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 2 | 100 ug |
$436.00
|
|
LY417084 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 1 | 100 ug |
$436.00
|
|
LY423484 | Transient overexpression lysate of tripartite motif-containing 13 (TRIM13), transcript variant 4 | 100 ug |
$436.00
|
|
TP309480 | Recombinant protein of human tripartite motif-containing 13 (TRIM13), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.