TCTN1 (NM_001082537) Human Mass Spec Standard

SKU
PH309467
TCTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001076006)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209467]
Predicted MW 63.6 kDa
Protein Sequence
Protein Sequence
>RC209467 protein sequence
Red=Cloning site Green=Tags(s)

MRPRGLPPLLVVLLGCWASVSAQTDATPAVTTEGLNSTEAALATFGTFPSTRPPGTPRAPGPSSGPRPTP
VTDVAVLCVCDLSPAQCDINCCCDPDCSSVDFSVFSACSVPVVTGDSQFCSQKAVIYSLNFTANPPQRVF
ELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYG
VPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRK
KVPITVQSIVIQSLNKTLTRREDTDVLQPTLVNAGHFSLCVNVVLEVKYSLTYTDAGEVTKADLSFVLGT
VSSVVVPLQQKFEIHFLQENTQPVPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQD
CLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHF
ITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANSGNERTILISTAVTFVDV
SAPAEAGFRAPPAINARLPFNFFFPFV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076006
RefSeq Size 2025
RefSeq ORF 1761
Synonyms JBTS13; TECT1
Locus ID 79600
UniProt ID Q2MV58
Cytogenetics 12q24.11
Summary This gene encodes a member of a family of secreted and transmembrane proteins. The orthologous gene in mouse functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. This protein is a component of the tectonic-like complex, which forms a barrier between the ciliary axoneme and the basal body. A mutation in this gene was found in a family with Joubert syndrome-13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:TCTN1 (NM_001082537) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411247 TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421188 TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411247 Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 3 100 ug
$436.00
LY421188 Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 2 100 ug
$436.00
TP309467 Recombinant protein of human tectonic family member 1 (TCTN1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.