DDX47 (NM_016355) Human Mass Spec Standard

SKU
PH309448
DDX47 MS Standard C13 and N15-labeled recombinant protein (NP_057439)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209448]
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC209448 protein sequence
Red=Cloning site Green=Tags(s)

MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAET
GSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALA
KKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTK
KVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTA
LLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHR
VGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEK
KKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057439
RefSeq Size 1836
RefSeq ORF 1365
Synonyms E4-DBP; HQ0256; MSTP162; RRP3
Locus ID 51202
UniProt ID Q9H0S4
Cytogenetics 12p13.1
Summary This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DDX47 (NM_016355) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404586 DDX47 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414030 DDX47 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404586 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 2 100 ug
$436.00
LY414030 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 1 100 ug
$436.00
TP309448 Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.