MRE11 (NM_005591) Human Mass Spec Standard

SKU
PH309414
MRE11A MS Standard C13 and N15-labeled recombinant protein (NP_005582)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209414]
Predicted MW 80.6 kDa
Protein Sequence
Protein Sequence
>RC209414 protein sequence
Red=Cloning site Green=Tags(s)

MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRK
TLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCA
LDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSW
FNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAV
KKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERE
RLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK
PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHI
DALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAEQMANDSDD
SISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQ
PSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNT
SSLRRNRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005582
RefSeq Size 5141
RefSeq ORF 2124
Synonyms ATLD; HNGS1; MRE11A; MRE11B
Locus ID 4361
UniProt ID P49959
Cytogenetics 11q21
Summary This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Homologous recombination, Non-homologous end-joining
Write Your Own Review
You're reviewing:MRE11 (NM_005591) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417199 MRE11A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417199 Transient overexpression lysate of MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 1 100 ug
$436.00
TP309414 Recombinant protein of human MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 1, 20 µg 20 ug
$867.00
TP761120 Purified recombinant protein of Human MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.