OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RHOJ (NM_020663) Human Mass Spec Standard

Be the first to review this product
SKU
PH309395
RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505592 RHOJ mouse monoclonal antibody, clone OTI1D7 (formerly 1D7) 100 ul
$447.00
LY412401 Transient overexpression lysate of ras homolog gene family, member J (RHOJ) (as WB positive control) 100 ug
$436.00

Other products for "RHOJ or NM_020663"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209395
Predicted MW 23.8 kDa
Protein Sequence
Protein Sequence
>RC209395 protein sequence
Red=Cloning site Green=Tags(s)

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
CSII

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065714
RefSeq Size 3619
RefSeq ORF 642
Synonyms ARHJ; RASL7B; TC10B; TCL
Locus ID 57381
UniProt ID Q9H4E5
Cytogenetics 14q23.2
Summary This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. provided by RefSeq, Dec 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RHOJ" proteins (3)
SKU Description Size Price
LC412401 Lyophilized RHOJ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412401 Transient overexpression lysate of ras homolog gene family, member J (RHOJ) (as WB positive control) 100 ug
$436.00
TP309395 Recombinant protein of human ras homolog gene family, member J (RHOJ), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products