RHOJ (NM_020663) Human Mass Spec Standard

SKU
PH309395
RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209395]
Predicted MW 23.8 kDa
Protein Sequence
Protein Sequence
>RC209395 protein sequence
Red=Cloning site Green=Tags(s)

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
CSII

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065714
RefSeq Size 3619
RefSeq ORF 642
Synonyms ARHJ; RASL7B; TC10B; TCL
Locus ID 57381
UniProt ID Q9H4E5
Cytogenetics 14q23.2
Summary This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RHOJ (NM_020663) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412401 RHOJ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412401 Transient overexpression lysate of ras homolog gene family, member J (RHOJ) 100 ug
$436.00
TP309395 Recombinant protein of human ras homolog gene family, member J (RHOJ), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.