Pyrophosphatase 1 (PPA1) (NM_021129) Human Mass Spec Standard

SKU
PH309393
PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209393]
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC209393 protein sequence
Red=Cloning site Green=Tags(s)

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK
QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV
LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF
KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV
DKWFHHQKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066952
RefSeq Size 1316
RefSeq ORF 867
Synonyms HEL-S-66p; IOPPP; PP; PP1; SID6-8061
Locus ID 5464
UniProt ID Q15181
Cytogenetics 10q22.1
Summary The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 2008]
Protein Families ES Cell Differentiation/IPS
Protein Pathways Oxidative phosphorylation
Write Your Own Review
You're reviewing:Pyrophosphatase 1 (PPA1) (NM_021129) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412068 PPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412068 Transient overexpression lysate of pyrophosphatase (inorganic) 1 (PPA1) 100 ug
$436.00
TP309393 Recombinant protein of human pyrophosphatase (inorganic) 1 (PPA1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.