PRMT3 (NM_005788) Human Mass Spec Standard

SKU
PH309382
PRMT3 MS Standard C13 and N15-labeled recombinant protein (NP_005779)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209382]
Predicted MW 59.9 kDa
Protein Sequence
Protein Sequence
>RC209382 protein sequence
Red=Cloning site Green=Tags(s)

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE
HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE
PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA
DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK
VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK
YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP
FSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005779
RefSeq Size 2743
RefSeq ORF 1593
Synonyms HRMT1L3
Locus ID 10196
UniProt ID O60678
Cytogenetics 11p15.1
Summary This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PRMT3 (NM_005788) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417075 PRMT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428738 PRMT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417075 Transient overexpression lysate of protein arginine methyltransferase 3 (PRMT3), transcript variant 1 100 ug
$436.00
LY428738 Transient overexpression lysate of protein arginine methyltransferase 3 (PRMT3), transcript variant 2 100 ug
$436.00
TP309382 Recombinant protein of human protein arginine methyltransferase 3 (PRMT3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.