NSMCE4A (NM_017615) Human Mass Spec Standard

SKU PH309357

NSMCE4A MS Standard C13 and N15-labeled recombinant protein (NP_060085)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC209357]
• Predicted MW: 44.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC209357 protein sequence; Red=Cloning site Green=Tags(s); ; MSGDSSGRGGRGRGRDHRDRTRSRSRSRSSRSRRGSARRRARSDTSDSGDMMDASAADGCRRHYRANSVN; RDNAGDKTVANTNVSRARAVDAHVASDGKKAKRSDSSDMRYVTTHMGVNARDDSDVYDSWKTGRTANTNK; THTHGSYGCVKRVDRRKVVRAMARRMSHATKVRGTYRDDTMSDVVDHSRTVNHVSRDGARRDDRVVSNNG; HNTVRNGASYRDWVKTSVTSRKSA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060085
• RefSeq Size: 1420
• RefSeq ORF: 1158
• Synonyms: C10orf86; NS4EA; NSE4A
• Locus ID: 54780
• UniProt ID: Q9NXX6
• Cytogenetics: 10q26.13
• Summary: Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Is involved in positive regulation of response to DNA damage stimulus.[UniProtKB/Swiss-Prot Function]