NOTUM (NM_178493) Human Mass Spec Standard

SKU
PH309331
NOTUM MS Standard C13 and N15-labeled recombinant protein (NP_848588)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209331]
Predicted MW 48.6 kDa
Protein Sequence
Protein Sequence
>RC209331 protein sequence
Red=Cloning site Green=Tags(s)

MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENC
DSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGAL
IIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRH
TDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTV
DNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDR
SLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPS
ELLGMLSNGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848588
RefSeq Size 2281
RefSeq ORF 1290
Synonyms hNOTUM
Locus ID 147111
UniProt ID Q6P988
Cytogenetics 17q25.3
Summary Carboxylesterase that acts as a key negative regulator of the Wnt signaling pathway by specifically mediating depalmitoleoylation of WNT proteins. Serine palmitoleoylation of WNT proteins is required for efficient binding to frizzled receptors (PubMed:25731175).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NOTUM (NM_178493) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405887 NOTUM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405887 Transient overexpression lysate of notum pectinacetylesterase homolog (Drosophila) (NOTUM) 100 ug
$436.00
TP309331 Recombinant protein of human notum pectinacetylesterase homolog (Drosophila) (NOTUM), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.