GNG2 (NM_053064) Human Mass Spec Standard
CAT#: PH309299
GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209299 |
Predicted MW | 7.9 kDa |
Protein Sequence |
>RC209299 protein sequence
Red=Cloning site Green=Tags(s) MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI L myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_444292 |
RefSeq Size | 3903 |
RefSeq ORF | 213 |
Locus ID | 54331 |
UniProt ID | P59768 |
Cytogenetics | 14q22.1 |
Summary | This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403285 | GNG2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403285 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 2 (GNG2) |
USD 436.00 |
|
TP309299 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 2 (GNG2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review