OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CNOT7 (NM_013354) Human Mass Spec Standard

Be the first to review this product
SKU
PH309293
CNOT7 MS Standard C13 and N15-labeled recombinant protein (NP_037486)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415657 Transient overexpression lysate of CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CNOT7 or NM_013354"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209293
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC209293 protein sequence
Red=Cloning site Green=Tags(s)

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD
LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL
MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ
EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE
ANKQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037486
RefSeq Size 2646
RefSeq ORF 855
Synonyms CAF-1; CAF1; Caf1a; hCAF-1
Locus ID 29883
UniProt ID Q9UIV1
Cytogenetics 8p22
Summary The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. provided by RefSeq, Apr 2016
Protein Families Transcription Factors
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CNOT7" proteins (5)
SKU Description Size Price
LC409310 Lyophilized CNOT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415657 Lyophilized CNOT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409310 Transient overexpression lysate of CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415657 Transient overexpression lysate of CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP309293 Recombinant protein of human CCR4-NOT transcription complex, subunit 7 (CNOT7), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products