SNAP-beta (NAPB) (NM_022080) Human Mass Spec Standard

SKU
PH309278
NAPB MS Standard C13 and N15-labeled recombinant protein (NP_071363)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209278]
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC209278 protein sequence
Red=Cloning site Green=Tags(s)

MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSAAGNAFCQAAK
LHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIYETELVDIEK
AIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKDYFFKAA
LCHFIVDELNAKLALEKYEEMFPAFTDSRECKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTML
LRIKKSIQGDGEGDGDLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071363
RefSeq Size 3871
RefSeq ORF 894
Synonyms SNAP-BETA; SNAPB
Locus ID 63908
UniProt ID Q9H115
Cytogenetics 20p11.21
Summary This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:SNAP-beta (NAPB) (NM_022080) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411803 NAPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411803 Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, beta (NAPB) 100 ug
$436.00
TP309278 Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, beta (NAPB), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.